PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015897478.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 347aa    MW: 37080.2 Da    PI: 9.0057
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015897478.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1239.8e-3962121362
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     e++lkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  XP_015897478.1  62 ETSLKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 121
                     6789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3145110IPR003851Zinc finger, Dof-type
PfamPF027012.4E-3264119IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.54465119IPR003851Zinc finger, Dof-type
PROSITE patternPS01361067103IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MVFSSIPAYH DPSNWQQFLP PPLPPPQTLP PPSQPHGVGG SGSIRPGSMA DRARMANIPM  60
PETSLKCPRC ESTNTKFCYF NNYSLTQPRH FCKTCRRYWT RGGALRNVPV GGGCRRNKRS  120
KGSSSSKSPV SSDRQTGSST PSGSSTSSLP SNNTLAPPDI IGLTNQVPSL RLMAPLHHHL  180
TDFAEMGFNY GALNYAAMGG GGDFNFQIGS SSTGSLGRLP TDGMMDHQWR LQQASQFPFM  240
ATAGLDPSQP PPPAGLFESG GVDALGYHHH LRTKSTTSGL ASQLASVKME DHQSTEMNLS  300
KQLLGISSNI NPGNDDNQYW SGGGTSNTTA WTDLSGFSSS STTSNPL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015897478.10.0PREDICTED: dof zinc finger protein DOF5.1-like isoform X2
TrEMBLA0A061ET141e-107A0A061ET14_THECC; DNA binding with one finger 2.4, putative
STRINGVIT_08s0007g00180.t016e-96(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.23e-41OBF-binding protein 3